PDB entry 2d2y

View 2d2y on RCSB PDB site
Description: Crystal structure of the conserved hypothetical protein Rv1873 from Mycobacterium tuberculosis at 1.58 A
Class: structural genomics, unknown function
Keywords: X-ray crystallography, Rv1873, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2005-09-21, released 2005-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2007-01-30, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.169
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Rv1873
    Species: Mycobacterium tuberculosis
    Gene: H37Rv
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2d2ya_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2d2yA (A:)
mksasdpfdlkrfvyaqapvyrsvveelragrkrghwmwfvfpqlrglgssplavrygis
sleeaqaylqhdllgprlhectglvnqvqgrsieeifgppddlklcssmtlfaratdanq
dfvallakyygggedrrtvallavt

    Sequence, based on observed residues (ATOM records): (download) 
    >2d2yA (A:)
dpfdlkrfvyaqapvyrsvveelragrkrghwmwfvfpqlrglgssplavrygissleea
qaylqhdllgprlhectglvnqvqgrsieeifgppddlklcssmtlfaratdanqdfval
lakyygggedrrtvallavt