PDB entry 2d2w

View 2d2w on RCSB PDB site
Description: Solution structure and Dynamics of the DNA-Binding Domain of Myocyte Nuclear Factor
Class: DNA binding protein
Keywords: DNA-binding domain, winged-helix, Forkhead, NMR, DNA BINDING PROTEIN
Deposited on 2005-09-19, released 2006-09-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Forkhead box protein K1
    Species: Mus musculus [TaxId:10090]
    Gene: Foxk1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2d2wa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d2wA (A:)
    eskppysyaqlivqaissaqdrqltlsgiyahitkhypyyrtadkgwqnsirhnlslnry
    fikvprsqeepgkgsfwridpaseaklveqafrkrrqrgvs