PDB entry 2d2h

View 2d2h on RCSB PDB site
Description: OpdA from Agrobacterium radiobacter with bound inhibitor trimethyl phosphate at 1.8 A resolution
Class: hydrolase
Keywords: phosphotriesterase, metalloenzyme, OpdA, HYDROLASE
Deposited on 2005-09-09, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-19, with a file datestamp of 2015-08-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93LD7 (0-328)
      • engineered mutation (59)
    Domains in SCOPe 2.07: d2d2ha_
  • Heterogens: CO, TZZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d2hA (A:)
    tgdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrhara
    agvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflr
    eiqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqq
    aaifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegnasalalf
    gtrswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrv
    ipflrekgvppetlagvtvanparflspt