PDB entry 2d2d

View 2d2d on RCSB PDB site
Description: Crystal Structure Of SARS-CoV Mpro in Complex with an Inhibitor I2
Class: Hydrolase
Keywords: Anti-parallel B-barrel, anti-parallel A-helices, Hydrolase
Deposited on 2005-09-08, released 2005-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.209
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2d2da_
  • Chain 'B':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2d2db_
  • Heterogens: ENB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d2dA (A:)
    gplgssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnye
    dllirksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvl
    acyngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagt
    dlegkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvam
    kynyepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfd
    vvrqcsgvtfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2dA (A:)
    frkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirks
    nhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngsp
    sgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkfy
    gpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyepl
    tqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcsg
    v
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d2dB (B:)
    gplgssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnye
    dllirksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvl
    acyngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagt
    dlegkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvam
    kynyepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfd
    vvrqcsgvtfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2dB (B:)
    sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
    ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
    spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
    fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
    pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
    sg