PDB entry 2d2a

View 2d2a on RCSB PDB site
Description: Crystal Structure of Escherichia coli SufA Involved in Biosynthesis of Iron-sulfur Clusters
Class: metal transport
Keywords: Iron-sulfur cluster, iron, SUF, SufA, IscA, YadR, METAL TRANSPORT
Deposited on 2005-09-05, released 2005-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SufA protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2d2aa_
  • Chain 'B':
    Compound: SufA protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2d2ab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d2aA (A:)
    mghhhhhhhhhhssghiddddlhmdmhsgtfnpqdfawqgltltpaaaihirelvakqpg
    mvgvrlgvkqtgcagfgyvldsvsepdkddllfehdgaklfvplqampfidgtevdfvre
    glnqifkfhnpkaqnecgcgesfgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2aA (A:)
    npqdfawqgltltpaaaihirelvakqpgmvgvrlgvkqtgcagfgyvldsvsepdkddl
    lfehdgaklfvplqampfidgtevdfvreglnqifkfhnpkaqnecgcgesfgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d2aB (B:)
    mghhhhhhhhhhssghiddddlhmdmhsgtfnpqdfawqgltltpaaaihirelvakqpg
    mvgvrlgvkqtgcagfgyvldsvsepdkddllfehdgaklfvplqampfidgtevdfvre
    glnqifkfhnpkaqnecgcgesfgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2aB (B:)
    sgtfnpqdfawqgltltpaaaihirelvakqpgmvgvrlgvkqgfgyvldsvsepdkddl
    lfehdgaklfvplqampfidgtevdfvreglnqifkfhnpka