PDB entry 2d29

View 2d29 on RCSB PDB site
Description: Structural study on project ID TT0172 from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: dehydrogenase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, OXIDOREDUCTASE
Deposited on 2005-09-05, released 2006-03-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.185
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2d29a1, d2d29a2
  • Chain 'B':
    Compound: acyl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2d29b1, d2d29b2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d29A (A:)
    mglwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpea
    yggaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasge
    algawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppsp
    erkhqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallgergkgfyd
    vlrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaeaatelea
    arllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdypverywr
    darltrigegtseilklviarrlleav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d29A (A:)
    glwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpeay
    ggaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasgea
    lgawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppspe
    rkhqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallgergkgfydv
    lrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaeaateleaa
    rllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdypverywrd
    arltrigegtseilklviarrlleav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d29B (B:)
    mglwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpea
    yggaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasge
    algawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppsp
    erkhqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallgergkgfyd
    vlrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaeaatelea
    arllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdypverywr
    darltrigegtseilklviarrlleav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d29B (B:)
    glwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpeay
    ggaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasgea
    lgawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppspe
    rkhqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallgergkgfydv
    lrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaeaateleaa
    rllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdypverywrd
    arltrigegtseilklviarrlleav