PDB entry 2d27

View 2d27 on RCSB PDB site
Description: Structure of the N-terminal domain of XpsE (crystal form I4122)
Class: protein transport
Keywords: alpha-beta sandwich, PROTEIN TRANSPORT
Deposited on 2005-09-03, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.195
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type II secretion ATPase XpsE
    Species: Xanthomonas campestris [TaxId:339]
    Gene: xpsE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31742 (0-End)
      • modified residue (0)
      • modified residue (36)
      • modified residue (78)
    Domains in SCOPe 2.07: d2d27a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d27A (A:)
    meqrsaetriveallerrrlkdtdllrarqlqaesgmgllallgrlglvserdhaetcae
    vlglplvdarqlgdtppemlpevqglslrflkqfhlcpvgerdgrldlwiadpyddyaid
    avrlatglplllhvglrseiddlierwyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d27A (A:)
    meqrsaetriveallerrrlkdtdllrarqlqaesgmgllallgrlglvserdhaetcae
    vlglplvdarqlgdtppemlpevqglslrflkqfhlcpvgerdgrldlwiadpyddyaid
    avrlatglplllhvglrseiddlierwy