PDB entry 2d1o

View 2d1o on RCSB PDB site
Description: Stromelysin-1 (MMP-3) complexed to a hydroxamic acid inhibitor
Class: hydrolase
Keywords: hydorolase metalloprotease
Deposited on 2005-08-30, released 2006-06-27
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.183
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stromelysin-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2d1oa1
  • Chain 'B':
    Compound: stromelysin-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2d1ob1
  • Heterogens: ZN, CA, FA4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d1oA (A:)
    frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
    misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
    ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d1oB (B:)
    frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
    misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
    ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d1oB (B:)
    frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
    misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
    ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp