PDB entry 2d1h

View 2d1h on RCSB PDB site
Description: Crystal structure of ST1889 protein from thermoacidophilic archaeon Sulfolobus tokodaii
Class: transcription
Keywords: HELIX-TURN-HELIX, INTERMOLECULAR AND INTRAMOLECULAR S-S BONDS, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-08-22, released 2006-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.237
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 109aa long hypothetical transcriptional regulator
    Species: Sulfolobus tokodaii [TaxId:273063]
    Gene: ST1889
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96ZE4 (0-108)
      • modified residue (0-1)
      • modified residue (29)
      • modified residue (103)
    Domains in SCOPe 2.07: d2d1ha1
  • Chain 'B':
    Compound: 109aa long hypothetical transcriptional regulator
    Species: Sulfolobus tokodaii [TaxId:273063]
    Gene: ST1889
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96ZE4 (0-108)
      • modified residue (0)
      • modified residue (29)
      • modified residue (103)
    Domains in SCOPe 2.07: d2d1hb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2d1hA (A:)
mmkekleskkdeirccykitdtdvavllkmveiekpitseeladifklskttvenslkkl
ielglvvrtktegkkigrpkyyysissnilekirndllncakrmelaat

    Sequence, based on observed residues (ATOM records): (download) 
    >2d1hA (A:)
mmkekleskkdeirccykitdtdvavllkmveiekpitseeladifklskttvenslkkl
ielglvvrtktpkyyysissnilekirndllncakrmelaat

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2d1hB (B:)
mmkekleskkdeirccykitdtdvavllkmveiekpitseeladifklskttvenslkkl
ielglvvrtktegkkigrpkyyysissnilekirndllncakrmelaat

    Sequence, based on observed residues (ATOM records): (download) 
    >2d1hB (B:)
mkleskkdeirccykitdtdvavllkmveiekpitseeladifklskttvenslkkliel
glvvrtktpkyyysissnilekirndllncakrmelaat