PDB entry 2d16

View 2d16 on RCSB PDB site
Description: Crystal Structure of PH1918 protein from Pyrococcus horikoshii OT3
Class: structural genomics, unknown function
Keywords: Hypothetical, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-08-14, released 2006-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.185
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH1918
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d16a_
  • Chain 'B':
    Compound: hypothetical protein PH1918
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d16b_
  • Chain 'C':
    Compound: hypothetical protein PH1918
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d16c_
  • Chain 'D':
    Compound: hypothetical protein PH1918
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d16d_
  • Heterogens: NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d16A (A:)
    mvrievidiekpegveviigqgnfsiftvddlaralltavpgikfgiamneakpqltryt
    gndpelealaaknavkigaghvfvilmknaypinvlntiknhpavamiygasenpfqviv
    aetelgravigvvdgkaankietdeqkkerrelvekigykid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d16B (B:)
    mvrievidiekpegveviigqgnfsiftvddlaralltavpgikfgiamneakpqltryt
    gndpelealaaknavkigaghvfvilmknaypinvlntiknhpavamiygasenpfqviv
    aetelgravigvvdgkaankietdeqkkerrelvekigykid
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d16B (B:)
    vrievidiekpegveviigqgnfsiftvddlaralltavpgikfgiamneakpqltrytg
    ndpelealaaknavkigaghvfvilmknaypinvlntiknhpavamiygasenpfqviva
    etelgravigvvdgkaankietdeqkkerrelvekigykid
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d16C (C:)
    mvrievidiekpegveviigqgnfsiftvddlaralltavpgikfgiamneakpqltryt
    gndpelealaaknavkigaghvfvilmknaypinvlntiknhpavamiygasenpfqviv
    aetelgravigvvdgkaankietdeqkkerrelvekigykid
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2d16D (D:)
    mvrievidiekpegveviigqgnfsiftvddlaralltavpgikfgiamneakpqltryt
    gndpelealaaknavkigaghvfvilmknaypinvlntiknhpavamiygasenpfqviv
    aetelgravigvvdgkaankietdeqkkerrelvekigykid
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d16D (D:)
    vrievidiekpegveviigqgnfsiftvddlaralltavpgikfgiamneakpqltrytg
    ndpelealaaknavkigaghvfvilmknaypinvlntiknhpavamiygasenpfqviva
    etelgravigvvdgkaankietdeqkkerrelvekigykid