PDB entry 2d11

View 2d11 on RCSB PDB site
Description: Crystal structure of the Radixin FERM domain complexed with the NHERF-2 C-terminal tail peptide
Class: Cell Adhesion
Keywords: Protein-peptide complex, Cell Adhesion
Deposited on 2005-08-11, released 2006-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.223
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Radixin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d11a1, d2d11a2, d2d11a3
  • Chain 'B':
    Compound: Radixin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d11b1, d2d11b2, d2d11b3
  • Chain 'C':
    Compound: Radixin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d11c1, d2d11c2, d2d11c3
  • Chain 'D':
    Compound: Radixin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d11d1, d2d11d2, d2d11d3
  • Chain 'E':
    Compound: Na(+)/H(+) exchange regulatory cofactor NHE-RF2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Na(+)/H(+) exchange regulatory cofactor NHE-RF2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Na(+)/H(+) exchange regulatory cofactor NHE-RF2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Na(+)/H(+) exchange regulatory cofactor NHE-RF2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d11A (A:)
    gsmpkpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystw
    lklnkkvtqqdvkkenplqfkfrakffpedvseeliqeitqrlfflqvkeailndeiycp
    petavllasyavqakygdynkeihkpgylandrllpqrvleqhkltkeqweeriqnwhee
    hrgmlredsmmeylkiaqdlemygvnyfeiknkkgtelwlgvdalglniyehddkltpki
    gfpwseirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpd
    tievqqmkaqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d11A (A:)
    kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln
    kkvtqqdvkkenplqfkfrakffpedvseeliqeitqrlfflqvkeailndeiycppeta
    vllasyavqakygdynkeihkpgylandrllpqrvleqhkltkeqweeriqnwheehrgm
    lredsmmeylkiaqdlemygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpw
    seirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d11B (B:)
    gsmpkpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystw
    lklnkkvtqqdvkkenplqfkfrakffpedvseeliqeitqrlfflqvkeailndeiycp
    petavllasyavqakygdynkeihkpgylandrllpqrvleqhkltkeqweeriqnwhee
    hrgmlredsmmeylkiaqdlemygvnyfeiknkkgtelwlgvdalglniyehddkltpki
    gfpwseirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpd
    tievqqmkaqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d11B (B:)
    kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln
    kkvtqqdvkkenplqfkfrakffpedvseeliqeitqrlfflqvkeailndeiycppeta
    vllasyavqakygdynkeihkpgylandrllpqrvleqhkltkeqweeriqnwheehrgm
    lredsmmeylkiaqdlemygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpw
    seirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d11C (C:)
    gsmpkpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystw
    lklnkkvtqqdvkkenplqfkfrakffpedvseeliqeitqrlfflqvkeailndeiycp
    petavllasyavqakygdynkeihkpgylandrllpqrvleqhkltkeqweeriqnwhee
    hrgmlredsmmeylkiaqdlemygvnyfeiknkkgtelwlgvdalglniyehddkltpki
    gfpwseirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpd
    tievqqmkaqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d11C (C:)
    kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln
    kkvtqqdvkkenplqfkfrakffpedvseeliqeitqrlfflqvkeailndeiycppeta
    vllasyavqakygdynkeihkpgylandrllpqrvleqhkltkeqweeriqnwheehrgm
    lredsmmeylkiaqdlemygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpw
    seirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2d11D (D:)
    gsmpkpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystw
    lklnkkvtqqdvkkenplqfkfrakffpedvseeliqeitqrlfflqvkeailndeiycp
    petavllasyavqakygdynkeihkpgylandrllpqrvleqhkltkeqweeriqnwhee
    hrgmlredsmmeylkiaqdlemygvnyfeiknkkgtelwlgvdalglniyehddkltpki
    gfpwseirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpd
    tievqqmkaqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d11D (D:)
    kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln
    kkvtqqdvkkenplqfkfrakffpedvseeliqeitqrlfflqvkeailndeiycppeta
    vllasyavqakygdynkeihkpgylandrllpqrvleqhkltkeqweeriqnwheehrgm
    lredsmmeylkiaqdlemygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpw
    seirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrk
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.