PDB entry 2d0v

View 2d0v on RCSB PDB site
Description: Crystal structure of methanol dehydrogenase from Hyphomicrobium denitrificans
Class: oxidoreductase
Keywords: electron transfer, oxidoreductase, calcium binding, methanol, PQQ
Deposited on 2005-08-09, released 2006-08-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.159
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methanol dehydrogenase large subunit
    Species: Hyphomicrobium denitrificans [TaxId:53399]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2d0va_
  • Chain 'B':
    Compound: methanol dehydrogenase small subunit
    Species: Hyphomicrobium denitrificans [TaxId:53399]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2d0vb_
  • Chain 'D':
    Compound: methanol dehydrogenase large subunit
    Species: Hyphomicrobium denitrificans [TaxId:53399]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2d0vd_
  • Chain 'E':
    Compound: methanol dehydrogenase small subunit
    Species: Hyphomicrobium denitrificans [TaxId:53399]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2d0ve_
  • Chain 'I':
    Compound: methanol dehydrogenase large subunit
    Species: Hyphomicrobium denitrificans [TaxId:53399]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2d0vi_
  • Chain 'J':
    Compound: methanol dehydrogenase small subunit
    Species: Hyphomicrobium denitrificans [TaxId:53399]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2d0vj_
  • Heterogens: CA, PQQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d0vA (A:)
    ndklielsnsnenwvmpgknydsnnyststqinvdnvkqlkhawsfstgelhghegaplv
    igdvmyvhssfpnktfaldlndpghilwqhspkqdpaarsvaccdlvnrglaywpgddkt
    psliiktqldghlvalnaktgeefwkvengdikvgqtltqapyvvhdlaivgssgaelgv
    rghvtaynvrtgeqawryyatgpdaeigladdfnsanphygqkglgtatwegdawkiggg
    tnwgwyaydpaanliyygsgnpapwnetmrpgdnkwtmtitardadtgkmkfgyqktphd
    ewdfagvnvimlseqtdktgkkrkllthpdrngivytldrengdlisadklddtvnvfkt
    vdlktglpvrdpeygtrmdhkgtdicpsamgyhnqghdsydpqkqlffmginhicmdwep
    fmlpyragqffvgatlwmypgpkgdrqnylglgqikaynaitneykwqhmerfsvwggtl
    atagnlvfygtldgflkarnsdtgelvwkhklpsgvigypmtyehkgvqyiavmsgvggw
    pgvglvfdlqdptaglgavgafknlqnytqmggslevfsldgknpyddvnvgeyekg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d0vB (B:)
    ydgthckapgncwepkpgfpekiagskydpkhdpkelnkqvesrkgeeernanraehfkk
    tgkwvydvkkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d0vB (B:)
    ydgthckapgncwepkpgfpekiagskydpkhdpkelnkqvesrkgeeernanraehfkk
    tgkwvydvkk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d0vD (D:)
    ndklielsnsnenwvmpgknydsnnyststqinvdnvkqlkhawsfstgelhghegaplv
    igdvmyvhssfpnktfaldlndpghilwqhspkqdpaarsvaccdlvnrglaywpgddkt
    psliiktqldghlvalnaktgeefwkvengdikvgqtltqapyvvhdlaivgssgaelgv
    rghvtaynvrtgeqawryyatgpdaeigladdfnsanphygqkglgtatwegdawkiggg
    tnwgwyaydpaanliyygsgnpapwnetmrpgdnkwtmtitardadtgkmkfgyqktphd
    ewdfagvnvimlseqtdktgkkrkllthpdrngivytldrengdlisadklddtvnvfkt
    vdlktglpvrdpeygtrmdhkgtdicpsamgyhnqghdsydpqkqlffmginhicmdwep
    fmlpyragqffvgatlwmypgpkgdrqnylglgqikaynaitneykwqhmerfsvwggtl
    atagnlvfygtldgflkarnsdtgelvwkhklpsgvigypmtyehkgvqyiavmsgvggw
    pgvglvfdlqdptaglgavgafknlqnytqmggslevfsldgknpyddvnvgeyekg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2d0vE (E:)
    ydgthckapgncwepkpgfpekiagskydpkhdpkelnkqvesrkgeeernanraehfkk
    tgkwvydvkkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d0vE (E:)
    ydgthckapgncwepkpgfpekiagskydpkhdpkelnkqvesrkgeeernanraehfkk
    tgkwvydv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2d0vI (I:)
    ndklielsnsnenwvmpgknydsnnyststqinvdnvkqlkhawsfstgelhghegaplv
    igdvmyvhssfpnktfaldlndpghilwqhspkqdpaarsvaccdlvnrglaywpgddkt
    psliiktqldghlvalnaktgeefwkvengdikvgqtltqapyvvhdlaivgssgaelgv
    rghvtaynvrtgeqawryyatgpdaeigladdfnsanphygqkglgtatwegdawkiggg
    tnwgwyaydpaanliyygsgnpapwnetmrpgdnkwtmtitardadtgkmkfgyqktphd
    ewdfagvnvimlseqtdktgkkrkllthpdrngivytldrengdlisadklddtvnvfkt
    vdlktglpvrdpeygtrmdhkgtdicpsamgyhnqghdsydpqkqlffmginhicmdwep
    fmlpyragqffvgatlwmypgpkgdrqnylglgqikaynaitneykwqhmerfsvwggtl
    atagnlvfygtldgflkarnsdtgelvwkhklpsgvigypmtyehkgvqyiavmsgvggw
    pgvglvfdlqdptaglgavgafknlqnytqmggslevfsldgknpyddvnvgeyekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d0vI (I:)
    ndklielsnsnenwvmpgknydsnnyststqinvdnvkqlkhawsfstgelhghegaplv
    igdvmyvhssfpnktfaldlndpghilwqhspkqdpaarsvaccdlvnrglaywpgddkt
    psliiktqldghlvalnaktgeefwkvengdikvgqtltqapyvvhdlaivgssgaelgv
    rghvtaynvrtgeqawryyatgpdaeigladdfnsanphygqkglgtatwegdawkiggg
    tnwgwyaydpaanliyygsgnpapwnetmrpgdnkwtmtitardadtgkmkfgyqktphd
    ewdfagvnvimlseqtdktgkkrkllthpdrngivytldrengdlisadklddtvnvfkt
    vdlktglpvrdpeygtrmdhkgtdicpsamgyhnqghdsydpqkqlffmginhicmdwep
    fmlpyragqffvgatlwmypgpkgdrqnylglgqikaynaitneykwqhmerfsvwggtl
    atagnlvfygtldgflkarnsdtgelvwkhklpsgvigypmtyehkgvqyiavmsgvggw
    pgvglvfdlqdptaglgavgafknlqnytqmggslevfsldgknpyddvnvgeye
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2d0vJ (J:)
    ydgthckapgncwepkpgfpekiagskydpkhdpkelnkqvesrkgeeernanraehfkk
    tgkwvydvkkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d0vJ (J:)
    ydgthckapgncwepkpgfpekiagskydpkhdpkelnkqvesrkgeeernanraehfkk
    tgkwvydvkk