PDB entry 2d0o

View 2d0o on RCSB PDB site
Description: Strcuture of diol dehydratase-reactivating factor complexed with ADP and Mg2+
Class: chaperone
Keywords: chaperone
Deposited on 2005-08-05, released 2006-02-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diol dehydratase-reactivating factor large subunit
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed):
    • GB AAC15871 (0-End)
    Domains in SCOPe 2.06: d2d0oa1, d2d0oa2, d2d0oa3
  • Chain 'B':
    Compound: diol dehydratase-reactivating factor small subunit
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed):
    • GB AAC15872
    Domains in SCOPe 2.06: d2d0ob1
  • Chain 'C':
    Compound: diol dehydratase-reactivating factor large subunit
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed):
    • GB AAC15871 (0-End)
    Domains in SCOPe 2.06: d2d0oc1, d2d0oc2, d2d0oc3
  • Chain 'D':
    Compound: diol dehydratase-reactivating factor small subunit
    Species: Klebsiella oxytoca [TaxId:571]
    Database cross-references and differences (RAF-indexed):
    • GB AAC15872
    Domains in SCOPe 2.06: d2d0od_
  • Heterogens: SO4, MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d0oA (A:)
    mryiagidignsstevalatldeagaltithsalaettgikgtlrnvfgiqealalvarg
    agiavsdislirineatpvigdvametitetiitestmighnpktpggaglgtgititpq
    elltrpadapyilvvssafdfadiasvinaslragyqitgvilqrddgvlvsnrlekplp
    ivdevlyidriplgmlaaievavpgkvietlsnpygiatvfnlspeetknivpmaralig
    nrsavvvktpsgdvkaraipagnlellaqgrsvrvdvaagaeaimkavdgcgrldnvtge
    sgtniggmlehvrqtmaeltnkpsseifiqdllavdtsvpvsvtgglagefsleqavgia
    smvksdrlqmamiareieqklnidvqiggaeaeaailgalttpgttrplaildlgagstd
    asiinpkgdiiathlagagdmvtmiiarelgledrylaeeikkyplakveslfhlrhedg
    svqffstplppavfarvcvvkadelvplpgdlalekvrairrsakervfvtnalralrqv
    sptgnirdipfvvlvggssldfevpqlvtdalahyrlvagrgnirgsegprnavatglil
    swhkefaher
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d0oA (A:)
    mryiagidignsstevalatldeagaltithsalaettgikgtlrnvfgiqealalvarg
    agiavsdislirineatpvigdvametitetiitestmighnpktpggaglgtgititpq
    elltrpadapyilvvssafdfadiasvinaslragyqitgvilqrddgvlvsnrlekplp
    ivdevlyidriplgmlaaievavpgkvietlsnpygiatvfnlspeetknivpmaralig
    nrsavvvktpsgdvkaraipagnlellaqgrsvrvdvaagaeaimkavdgcgrldnvtge
    sgtniggmlehvrqtmaeltnkpsseifiqdllavdtsvpvsvtgglagefsleqavgia
    smvksdrlqmamiareieqklnidvqiggaeaeaailgalttpgttrplaildlgagstd
    asiinpkgdiiathlagagdmvtmiiarelgledrylaeeikkyplakveslfhlrhedg
    svqffstplppavfarvcvvkadelvplpgdlalekvrairrsakervfvtnalralrqv
    sptgnirdipfvvlvggssldfevpqlvtdalahyrlvagrgnirgsegprnavatglil
    swhkef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d0oB (B:)
    mngnhsapaiaiavidgcdglwrevllgieeegipfrlqhhpagevvdsawqaarsspll
    vgiacdrhmlvvhyknlpasaplftlmhhqdsqahrntgnnaarlvkgipfrdlnseatg
    eqqde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d0oB (B:)
    hsapaiaiavidgcdglwrevllgieeegipfrlqhhpagevvdsawqaarsspllvgia
    cdrhmlvvhyknlpasaplftlmhhqdsqahrntgnnaarlvkgipfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d0oC (C:)
    mryiagidignsstevalatldeagaltithsalaettgikgtlrnvfgiqealalvarg
    agiavsdislirineatpvigdvametitetiitestmighnpktpggaglgtgititpq
    elltrpadapyilvvssafdfadiasvinaslragyqitgvilqrddgvlvsnrlekplp
    ivdevlyidriplgmlaaievavpgkvietlsnpygiatvfnlspeetknivpmaralig
    nrsavvvktpsgdvkaraipagnlellaqgrsvrvdvaagaeaimkavdgcgrldnvtge
    sgtniggmlehvrqtmaeltnkpsseifiqdllavdtsvpvsvtgglagefsleqavgia
    smvksdrlqmamiareieqklnidvqiggaeaeaailgalttpgttrplaildlgagstd
    asiinpkgdiiathlagagdmvtmiiarelgledrylaeeikkyplakveslfhlrhedg
    svqffstplppavfarvcvvkadelvplpgdlalekvrairrsakervfvtnalralrqv
    sptgnirdipfvvlvggssldfevpqlvtdalahyrlvagrgnirgsegprnavatglil
    swhkefaher
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d0oC (C:)
    mryiagidignsstevalatldeagaltithsalaettgikgtlrnvfgiqealalvarg
    agiavsdislirineatpvigdvametitetiitestmighnpktpggaglgtgititpq
    elltrpadapyilvvssafdfadiasvinaslragyqitgvilqrddgvlvsnrlekplp
    ivdevlyidriplgmlaaievavpgkvietlsnpygiatvfnlspeetknivpmaralig
    nrsavvvktpsgdvkaraipagnlellaqgrsvrvdvaagaeaimkavdgcgrldnvtge
    sgtniggmlehvrqtmaeltnkpsseifiqdllavdtsvpvsvtgglagefsleqavgia
    smvksdrlqmamiareieqklnidvqiggaeaeaailgalttpgttrplaildlgagstd
    asiinpkgdiiathlagagdmvtmiiarelgledrylaeeikkyplakveslfhlrhedg
    svqffstplppavfarvcvvkadelvplpgdlalekvrairrsakervfvtnalralrqv
    sptgnirdipfvvlvggssldfevpqlvtdalahyrlvagrgnirgsegprnavatglil
    swhk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2d0oD (D:)
    mngnhsapaiaiavidgcdglwrevllgieeegipfrlqhhpagevvdsawqaarsspll
    vgiacdrhmlvvhyknlpasaplftlmhhqdsqahrntgnnaarlvkgipfrdlnseatg
    eqqde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d0oD (D:)
    sapaiaiavidgcdglwrevllgieeegipfrlqhhpagevvdsawqaarsspllvgiac
    drhmlvvhyknlpasaplftlmhhqdsqahrntgnnaarlvkgipfrd