PDB entry 2d0n
View 2d0n on RCSB PDB site
Description: Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction
Class: signaling protein
Keywords: sh3 domain/complex, mona/gads sh3c domain, signaling protein
Deposited on
2005-08-04, released
2005-08-23
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.221
AEROSPACI score: 0.54
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: GRB2-related adaptor protein 2
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2d0na_ - Chain 'B':
Compound: SLP-76 binding peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: GRB2-related adaptor protein 2
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2d0nc_ - Chain 'D':
Compound: SLP-76 binding peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2d0nA (A:)
gspwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmmr
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>2d0nC (C:)
gspwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmmr
Sequence, based on observed residues (ATOM records): (download)
>2d0nC (C:)
pwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmm
- Chain 'D':
No sequence available.