PDB entry 2d0n

View 2d0n on RCSB PDB site
Description: Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction
Class: signaling protein
Keywords: sh3 domain/complex, mona/gads sh3c domain, signaling protein
Deposited on 2005-08-04, released 2005-08-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.221
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: GRB2-related adaptor protein 2
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O89100 (3-58)
    • cloning artifact (0-2)
  Domains in SCOPe 2.05: d2d0na_
• Chain 'B':
  Compound: SLP-76 binding peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2D0N (0-8)
• Chain 'C':
  Compound: GRB2-related adaptor protein 2
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O89100 (3-End)
    • cloning artifact (2)
  Domains in SCOPe 2.05: d2d0nc_
• Chain 'D':
  Compound: SLP-76 binding peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2D0N (0-8)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d0nA (A:)
  gspwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmmr
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >2d0nC (C:)
  gspwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmmr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2d0nC (C:)
  pwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmm
  

  
  
• Chain 'D':
  No sequence available.