PDB entry 2d0n

View 2d0n on RCSB PDB site
Description: Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction
Class: signaling protein
Keywords: sh3 domain/complex, mona/gads sh3c domain, signaling protein
Deposited on 2005-08-04, released 2005-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.221
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GRB2-related adaptor protein 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O89100 (3-58)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d2d0na2, d2d0na3
  • Chain 'B':
    Compound: SLP-76 binding peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2D0N (0-8)
  • Chain 'C':
    Compound: GRB2-related adaptor protein 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O89100 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.08: d2d0nc2, d2d0nc3
  • Chain 'D':
    Compound: SLP-76 binding peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2D0N (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d0nA (A:)
    gspwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmmr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d0nC (C:)
    gspwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d0nC (C:)
    pwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmm
    

  • Chain 'D':
    No sequence available.