PDB entry 2d0g

View 2d0g on RCSB PDB site
Description: Crystal Structure of Thermoactinomyces vulgaris R-47 Alpha-Amylase 1 (TVAI) Mutant D356N/E396Q complexed with P5, a pullulan model oligosaccharide
Class: Hydrolase
Keywords: ALPHA-AMYLASE, Hydrolase
Deposited on 2005-08-02, released 2006-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.15
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase I
    Species: Thermoactinomyces vulgaris [TaxId:2026]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60053 (0-636)
      • engineered (355)
      • engineered (395)
    Domains in SCOPe 2.07: d2d0ga1, d2d0ga2, d2d0ga3
  • Heterogens: GLC, BGC, CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d0gA (A:)
    aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw
    vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi
    ipnfktpdwlkngvmyqifpdrfyngdssndvqtgsytyngtptekkawgssvyadpgyd
    nslvffggdlagidqklgyikktlganilylnpifkaptnhkydtqdymavdpafgdnst
    lqtlindihstangpkgylildgvfnhtgdshpwfdkynnfssqgayesqsspwynyytf
    ytwpdsyasflgfnslpklnygnsgsavrgviynnsnsvaktylnppysvdgwrlnaaqy
    vdangnngsdvtnhqiwsefrnavkgvnsnaaiigqywgnanpwtaqgnqwdaatnfdgf
    tqpvsewitgkdyqnnsasisttqfdswlrgtranyptnvqqsmmnflsnhditrfatrs
    ggdlwktylalifqmtyvgtptiyygdeygmqggadpdnrrsfdwsqatpsnsavaltqk
    litirnqypalrtgsfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqls
    mpngstvtdkitghsytvqngmvtvavdghygavlaq