PDB entry 2d0e

View 2d0e on RCSB PDB site
Description: Substrate assited in Oxygen Activation in Cytochrome P450 158A2
Class: oxidoreductase
Keywords: streptomyces, Cytochrome P450 oxidoreductase, CYP158A2, proton transfer, dioxygen activation, 2-hydroxy-1, 4-naphthoquinone, oxidoreductase
Deposited on 2005-08-02, released 2005-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytochrome P450
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FCA6 (Start-403)
      • expression tag (404-406)
    Domains in SCOPe 2.07: d2d0ea1, d2d0ea2
  • Heterogens: HEM, NQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d0eA (A:)
    mteetisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddv
    rlvtndprfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargverv
    rersrgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlils
    sshgaevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllq
    iggeavtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialed
    veikgvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlar
    lesellvdavldrvpglklavapedvpfkkgalirgpealpvtwhha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d0eA (A:)
    etisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlv
    tndprfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargvervrer
    srgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlilsssh
    gaevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllqigg
    eavtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialedvei
    kgvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlarles
    ellvdavldrvpglklavapedvpfkkgalirgpealpvtwhha