PDB entry 2d07

View 2d07 on RCSB PDB site
Description: Crystal Structure of SUMO-3-modified Thymine-DNA Glycosylase
Class: hydrolase
Keywords: Hydrolase
Deposited on 2005-07-26, released 2006-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.208
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G/T mismatch-specific thymine DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d07a_
  • Chain 'B':
    Compound: Ubiquitin-like protein SMT3B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d07b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d07A (A:)
    gsngvseaelltktlpdiltfnldiviiginpglmaaykghhypgpgnhfwkclfmsgls
    evqlnhmddhtlpgkygigftnmverttpgskdlsskefreggrilvqklqkyqpriavf
    ngkciyeifskevfgvkvknlefglqphkipdtetlcyvmpsssarcaqfpraqdkvhyy
    iklkdlrdqlkgiernmdvqevqytfdlqlaqedakkmavkeekydpgye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d07A (A:)
    gvseaelltktlpdiltfnldiviiginpglmaaykghhypgpgnhfwkclfmsglsevq
    lnhmddhtlpgkygigftnmverttpglsskefreggrilvqklqkyqpriavfngkciy
    eifskevfgvkvknlefglqphkipdtetlcyvmpsssarcaqfpraqdkvhyyiklkdl
    rdqlkgiernmdvqevqytfdlqlaqedakkmavk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d07B (B:)
    madekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirf
    rfdgqpinetdtpaqlemededtidvfqqqtgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d07B (B:)
    ndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpa
    qlemededtidvfqqq