PDB entry 2d06

View 2d06 on RCSB PDB site
Description: Human Sult1A1 Complexed With Pap and estradiol
Class: transferase
Keywords: SULT 1A1, PAP, estradiol, substrarte inhibition, dead end complex, TRANSFERASE
Deposited on 2005-07-25, released 2005-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfotransferase 1A1
    Species: Homo sapiens [TaxId:9606]
    Gene: SULT1A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50225 (Start-294)
      • see remark 999 (212)
    Domains in SCOPe 2.08: d2d06a_
  • Chain 'B':
    Compound: Sulfotransferase 1A1
    Species: Homo sapiens [TaxId:9606]
    Gene: SULT1A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50225 (Start-294)
      • see remark 999 (212)
    Domains in SCOPe 2.08: d2d06b_
  • Heterogens: A3P, EST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d06A (A:)
    meliqdtsrppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildm
    iyqggdlekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlld
    qkvkvvyvarnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhvqeww
    elsrthpvlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtny
    ttvpqefmdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d06A (A:)
    srppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
    ekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
    varnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhvqewwelsrthp
    vlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtnyttvpqef
    mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d06B (B:)
    meliqdtsrppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildm
    iyqggdlekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlld
    qkvkvvyvarnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhvqeww
    elsrthpvlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtny
    ttvpqefmdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d06B (B:)
    srppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
    ekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
    varnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhvqewwelsrthp
    vlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtnyttvpqef
    mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel