PDB entry 2czz

View 2czz on RCSB PDB site
Description: Crystal structure of hypothetical protein PH1109 from pyrococcus horikoshii
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, SGCGES, Structural Genomics Consortium for Research on Gene Expression
Deposited on 2005-07-20, released 2006-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2007-01-23, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: hypothetical protein PH1109
    Species: Pyrococcus horikoshii
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2czzx_
  • Heterogens: CL, CA, COA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download) 
    >2czzX (X:)
meetrpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpkye
evlgrkcypsvldipdkievvdlfvkpkltmeyveqaikkgakvvwfqyntynreaskka
deagliivanrcmmreherllgek

    Sequence, based on observed residues (ATOM records): (download) 
    >2czzX (X:)
meetrpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpkye
evlgrkcypsvldipdkievvdlfvkpkltmeyveqaikkgakvvwfqyntynreaskka
deagliivanrcmmreherllg