PDB entry 2cze

View 2cze on RCSB PDB site
Description: Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3 complexed with UMP
Class: lyase
Keywords: Pyrimidine biosynthesis, Orotidine 5'-phosphate decarboxylase (OMPdecase), UMP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LYASE
Deposited on 2005-07-13, released 2006-01-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.163
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: pyrF, PH0731
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2czea_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: pyrF, PH0731
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2czeb_
  • Heterogens: U5P, CIT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2czeA (A:)
mivlaldvyegeraikiaksvkdyismikvnwplilgsgvdiirrlkeetgveiiadlkl
adipntnrliarkvfgagadyvivhtfvgrdsvmavkelgeiimvvemshpgalefinpl
tdrfievaneiepfgviapgtrperigyirdrlkegikilapgigaqggkakdavkagad
yiivgraiynapnpreaakaiydeirgv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2czeB (B:)
mivlaldvyegeraikiaksvkdyismikvnwplilgsgvdiirrlkeetgveiiadlkl
adipntnrliarkvfgagadyvivhtfvgrdsvmavkelgeiimvvemshpgalefinpl
tdrfievaneiepfgviapgtrperigyirdrlkegikilapgigaqggkakdavkagad
yiivgraiynapnpreaakaiydeirgv