PDB entry 2czd

View 2czd on RCSB PDB site
Description: Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3 at 1.6 A resolution
Class: lyase
Keywords: Pyrimidine biosynthesis, Orotidine 5'-phosphate decarboxylase (OMPdecase), Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LYASE
Deposited on 2005-07-13, released 2006-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.172
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: pyrF, PH0731
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2czda_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: pyrF, PH0731
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2czdb_
  • Heterogens: DTT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2czdA (A:)
    mivlaldvyegeraikiaksvkdyismikvnwplilgsgvdiirrlkeetgveiiadlkl
    adipntnrliarkvfgagadyvivhtfvgrdsvmavkelgeiimvvemshpgalefinpl
    tdrfievaneiepfgviapgtrperigyirdrlkegikilapgigaqggkakdavkagad
    yiivgraiynapnpreaakaiydeirgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2czdA (A:)
    mivlaldvyegeraikiaksvkdyismikvnwplilgsgvdiirrlkeetgveiiadlkl
    adipntnrliarkvfgagadyvivhtfvgrdsvmavkelgeiimvvemshpgalefinpl
    tdrfievaneiepfgviapgtrperigyirdrlkegikilapgigaqggkakdavkagad
    yiivgraiynapnpreaakaiydeir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2czdB (B:)
    mivlaldvyegeraikiaksvkdyismikvnwplilgsgvdiirrlkeetgveiiadlkl
    adipntnrliarkvfgagadyvivhtfvgrdsvmavkelgeiimvvemshpgalefinpl
    tdrfievaneiepfgviapgtrperigyirdrlkegikilapgigaqggkakdavkagad
    yiivgraiynapnpreaakaiydeirgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2czdB (B:)
    mivlaldvyegeraikiaksvkdyismikvnwplilgsgvdiirrlkeetgveiiadlkl
    adipntnrliarkvfgagadyvivhtfvgrdsvmavkelgeiimvvemshpgalefinpl
    tdrfievaneiepfgviapgtrperigyirdrlkegikilapgigaqggkakdavkagad
    yiivgraiynapnpreaakaiydeirg