PDB entry 2czc

View 2czc on RCSB PDB site
Description: Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Pyrococcus horikoshii OT3
Class: Oxidoreductase
Keywords: Glycolysis, NAD, Oxidoreductase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-07-13, released 2006-01-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1830
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2czca1, d2czca2
  • Chain 'B':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1830
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2czcb1, d2czcb2
  • Chain 'C':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1830
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2czcc1, d2czcc2
  • Chain 'D':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1830
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2czcd1, d2czcd2
  • Heterogens: PO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2czcA (A:)
    mkvkvgvngygtigkrvayavtkqddmeligitktkpdfeayrakelgipvyaaseefip
    rfekegfevagtlndllekvdiivdatpggigaknkplyekagvkaifqggekadvaevs
    fvaqanyeaalgknyvrvvscnttglvrtlsaireyadyvyavmirraadpndtkrgpin
    aikptvevpshhgpdvqtvipinietmafvvpttlmhvhsvmvelkkpltkddvidifen
    ttrvllfekekgfdstaqiiefardlhrewnnlyeiavwkesinikgnrlfyiqavhqes
    dvipenidairamfeladkwdsikktnkslgilk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2czcB (B:)
    mkvkvgvngygtigkrvayavtkqddmeligitktkpdfeayrakelgipvyaaseefip
    rfekegfevagtlndllekvdiivdatpggigaknkplyekagvkaifqggekadvaevs
    fvaqanyeaalgknyvrvvscnttglvrtlsaireyadyvyavmirraadpndtkrgpin
    aikptvevpshhgpdvqtvipinietmafvvpttlmhvhsvmvelkkpltkddvidifen
    ttrvllfekekgfdstaqiiefardlhrewnnlyeiavwkesinikgnrlfyiqavhqes
    dvipenidairamfeladkwdsikktnkslgilk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2czcB (B:)
    kvkvgvngygtigkrvayavtkqddmeligitktkpdfeayrakelgipvyaaseefipr
    fekegfevagtlndllekvdiivdatpggigaknkplyekagvkaifqggekadvaevsf
    vaqanyeaalgknyvrvvscnttglvrtlsaireyadyvyavmirraadpndtkrgpina
    ikptvevpshhgpdvqtvipinietmafvvpttlmhvhsvmvelkkpltkddvidifent
    trvllfekekgfdstaqiiefardlhrewnnlyeiavwkesinikgnrlfyiqavhqesd
    vipenidairamfeladkwdsikktnkslgilk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2czcC (C:)
    mkvkvgvngygtigkrvayavtkqddmeligitktkpdfeayrakelgipvyaaseefip
    rfekegfevagtlndllekvdiivdatpggigaknkplyekagvkaifqggekadvaevs
    fvaqanyeaalgknyvrvvscnttglvrtlsaireyadyvyavmirraadpndtkrgpin
    aikptvevpshhgpdvqtvipinietmafvvpttlmhvhsvmvelkkpltkddvidifen
    ttrvllfekekgfdstaqiiefardlhrewnnlyeiavwkesinikgnrlfyiqavhqes
    dvipenidairamfeladkwdsikktnkslgilk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2czcC (C:)
    kvkvgvngygtigkrvayavtkqddmeligitktkpdfeayrakelgipvyaaseefipr
    fekegfevagtlndllekvdiivdatpggigaknkplyekagvkaifqggekadvaevsf
    vaqanyeaalgknyvrvvscnttglvrtlsaireyadyvyavmirraadpndtkrgpina
    ikptvevpshhgpdvqtvipinietmafvvpttlmhvhsvmvelkkpltkddvidifent
    trvllfekekgfdstaqiiefardlhrewnnlyeiavwkesinikgnrlfyiqavhqesd
    vipenidairamfeladkwdsikktnkslgilk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2czcD (D:)
    mkvkvgvngygtigkrvayavtkqddmeligitktkpdfeayrakelgipvyaaseefip
    rfekegfevagtlndllekvdiivdatpggigaknkplyekagvkaifqggekadvaevs
    fvaqanyeaalgknyvrvvscnttglvrtlsaireyadyvyavmirraadpndtkrgpin
    aikptvevpshhgpdvqtvipinietmafvvpttlmhvhsvmvelkkpltkddvidifen
    ttrvllfekekgfdstaqiiefardlhrewnnlyeiavwkesinikgnrlfyiqavhqes
    dvipenidairamfeladkwdsikktnkslgilk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2czcD (D:)
    kvkvgvngygtigkrvayavtkqddmeligitktkpdfeayrakelgipvyaaseefipr
    fekegfevagtlndllekvdiivdatpggigaknkplyekagvkaifqggekadvaevsf
    vaqanyeaalgknyvrvvscnttglvrtlsaireyadyvyavmirraadpndtkrgpina
    ikptvevpshhgpdvqtvipinietmafvvpttlmhvhsvmvelkkpltkddvidifent
    trvllfekekgfdstaqiiefardlhrewnnlyeiavwkesinikgnrlfyiqavhqesd
    vipenidairamfeladkwdsikktnkslgil