PDB entry 2cz9

View 2cz9 on RCSB PDB site
Description: Crystal Structure of galactokinase from Pyrococcus horikoshi
Class: Transferase
Keywords: galactokinase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transferase
Deposited on 2005-07-12, released 2006-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.209
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable galactokinase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2cz9a1, d2cz9a2
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cz9A (A:)
    mikvkspgrvnligehtdytygyvmpmainlytkieaekhgevilysehfgeerkfslnd
    lrkenswidyvkgifwvlkesdyevggikgrvsgnlplgaglsssasfevgiletldkly
    nlkldslskvllakkaenefvgvpcgildqfavvfgregnvifldthtldyeyipfpkdv
    silvfytgvrrelasseyaerkhiaeeslkilgkgsskevregelsklpplhrkffgyiv
    renarvlevrdalkegnveevgkilttahwdlaknyevsckeldffveralklgaygarl
    tgagfggsaialvdkedaetigeeilreylkrfpwkarhfivepsdgvgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cz9A (A:)
    mikvkspgrvnligehtdytygyvmpmainlytkieaekhgevilysehfgeerkfslnd
    lrkenswidyvkgifwvlkesdyevggikgrvsgnlplgaglsssasfevgiletldkly
    nlkldslskvllakkaenefvgvpcgildqfavvfgregnvifldthtldyeyipfpkdv
    silvfytgvrsseyaerkhiaeeslkilgkgsskevregelsklpplhrkffgyivrena
    rvlevrdalkegnveevgkilttahwdlaknyevsckeldffveralklgaygarltgag
    fggsaialvdkedaetigeeilreylkrfpwkarhfivepsdgvgi