PDB entry 2cz5

View 2cz5 on RCSB PDB site
Description: Crystal structure of orotidine 5'-phosphate decarboxylase from Pyrococcus horikoshii OT3
Class: lyase
Keywords: Pyrimidine biosynthesis, Orotidine 5'-phosphate decarboxylase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-07-11, released 2006-01-11
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Pyrococcus horikoshii
    Gene: pyrF, PH0731
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cz5a1
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Pyrococcus horikoshii
    Gene: pyrF, PH0731
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cz5b1
  • Heterogens: CIT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cz5A (A:)
    mivlaldvyegeraikiaksvkdyismikvnwplilgsgvdiirrlkeetgveiiadlkl
    adipntnrliarkvfgagadyvivhtfvgrdsvmavkelgeiimvvemshpgalefinpl
    tdrfievaneiepfgviapgtrperigyirdrlkegikilapgigaqggkakdavkagad
    yiivgraiynapnpreaakaiydeirgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cz5B (B:)
    mivlaldvyegeraikiaksvkdyismikvnwplilgsgvdiirrlkeetgveiiadlkl
    adipntnrliarkvfgagadyvivhtfvgrdsvmavkelgeiimvvemshpgalefinpl
    tdrfievaneiepfgviapgtrperigyirdrlkegikilapgigaqggkakdavkagad
    yiivgraiynapnpreaakaiydeirgv