PDB entry 2cz0

View 2cz0 on RCSB PDB site
Description: photo-activation state of Fe-type NHase in aerobic condition
Class: lyase
Keywords: CYSTEINE-SULFINIC ACID, CYSTEINE-SULFENIC ACID, POST-TRANSLATIONAL MODIFICATION, NITRILE, HYDRATION, NON-HEM IRON, photo-reactive, over-oxidization , Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-07-09, released 2006-01-09
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.174
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrile hydratase subunit alpha
    Species: Rhodococcus erythropolis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13448
      • modified residue (111)
      • modified residue (113)
  • Chain 'B':
    Compound: Nitrile hydratase subunit beta
    Species: Rhodococcus erythropolis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cz0b1
  • Heterogens: FE, BUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cz0B (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cz0B (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepa