PDB entry 2cyx

View 2cyx on RCSB PDB site
Description: Structure of human ubiquitin-conjugating enzyme E2 G2 (UBE2G2/UBC7)
Class: Ligase
Keywords: Ubiquitin-conjugating enzyme (E2), Ubl conjugation pathway, Ligase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-07-08, released 2006-04-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.228
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 G2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2G2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60604 (5-169)
      • cloning artifact (1-4)
    Domains in SCOPe 2.03: d2cyxa_
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 G2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2G2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60604 (5-169)
      • cloning artifact (1-4)
    Domains in SCOPe 2.03: d2cyxb_
  • Chain 'C':
    Compound: Ubiquitin-conjugating enzyme E2 G2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2G2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60604 (5-169)
      • cloning artifact (1-4)
    Domains in SCOPe 2.03: d2cyxc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cyxA (A:)
    ggsefmagtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfp
    ailsfpldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqs
    vekillsvvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cyxA (A:)
    gsefmagtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpa
    ilsfpldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsv
    ekillsvvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cyxB (B:)
    ggsefmagtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfp
    ailsfpldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqs
    vekillsvvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cyxB (B:)
    gsefmagtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpa
    ilsfpldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsv
    ekillsvvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cyxC (C:)
    ggsefmagtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfp
    ailsfpldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqs
    vekillsvvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cyxC (C:)
    gsefmagtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpa
    ilsfpldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsv
    ekillsvvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl