PDB entry 2cym

View 2cym on RCSB PDB site
Description: effects of amino acid substitution on three-dimensional structure: an x-ray analysis of cytochrome c3 from desulfovibrio vulgaris hildenborough at 2 angstroms resolution
Class: electron transport
Keywords: electron transport
Deposited on 1993-09-29, released 1994-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cyma_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cymA (A:)
    apkapadglkmeatkqpvvfnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdk
    sakgyyhvmhdkntkfkscvgchvevagadaakkkdltgckkskche