PDB entry 2cyj

View 2cyj on RCSB PDB site
Description: Crystal structure of conserved hypothetical protein PH1505 from Pyrococcus horikoshii OT3
Class: structural genomics, unknown function
Keywords: Conserved Hypothetical Protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-07-07, released 2006-01-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.179
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH1505
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1505
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cyja1
  • Heterogens: ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cyjA (A:)
    mkieevrfglvkidgkefdhdiviypsgrierrmkeiskkkhgtshkldpeelekylved
    fdvllvgtgiygmlsllpeskklvedkeviekptkealklleelwgkkrilaiihvtc