PDB entry 2cyg

View 2cyg on RCSB PDB site
Description: Crystal structure at 1.45- resolution of the major allergen endo-beta-1,3-glucanase of banana as a molecular basis for the latex-fruit syndrome
Class: hydrolase
Keywords: endo-beta-1,3-glucanase, (beta-alpha)8-TIM-barrel, B-cell epitopes, allergen, banana, hydrolase
Deposited on 2005-07-07, released 2005-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.158
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-1, 3-glucananse
    Species: Musa acuminata [TaxId:4641]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22317 (0-311)
      • see remark 999 (253)
    Domains in SCOPe 2.08: d2cyga1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cygA (A:)
igvcygmlgnnlpppsevvslyksnniarmrlydpnqaalqalrnsniqvlldvprsdvq
slasnpsaagdwirrnvvaywpsvsfryiavgnelipgsdlaqyilpamrniynalssag
lqnqikvstavdtgvlgtsyppsagafssaaqaylspivqflasngapllvnvypyfsyt
gnpgqislpyalftasgvvvqdgrfsyqnlfdaivdavfaalervgganvavvvsesgwp
sagggaeastsnaqtynqnlirhvgggtprrpgkeieayifemfnenqkaggieqnfglf
ypnkqpvyqisf