PDB entry 2cye

View 2cye on RCSB PDB site
Description: Crystal structure of Thioesterase complexed with coenzyme A and Zn from Thermus thermophilus HB8
Class: hydrolase
Keywords: Structural Genomics, esterase, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2005-07-06, released 2006-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-01-05, with a file datestamp of 2009-12-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative thioesterase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA1846
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cyea1
  • Chain 'B':
    Compound: Putative thioesterase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA1846
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cyeb_
  • Chain 'C':
    Compound: Putative thioesterase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA1846
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cyec_
  • Chain 'D':
    Compound: Putative thioesterase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA1846
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cyed_
  • Heterogens: ZN, COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cyeA (A:)
    megfpvrvrvdvrfrdldplghvnnavflsymelariryfqrispdwleeghfvvarmev
    dylrpillgdevfvgvrtvglgrsslrmehlvtangesaakglgvlvwleggrpaplpea
    ireriralegrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cyeA (A:)
    megfpvrvrvdvrfrdldplghvnnavflsymelariryfqridwleeghfvvarmevdy
    lrpillgdevfvgvrtvglgrsslrmehlvtangesaakglgvlvwleggrpaplpeair
    eriralegrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cyeB (B:)
    megfpvrvrvdvrfrdldplghvnnavflsymelariryfqrispdwleeghfvvarmev
    dylrpillgdevfvgvrtvglgrsslrmehlvtangesaakglgvlvwleggrpaplpea
    ireriralegrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cyeB (B:)
    megfpvrvrvdvrfrdldplghvnnavflsymelariryfqridwleeghfvvarmevdy
    lrpillgdevfvgvrtvglgrsslrmehlvtangesaakglgvlvwleggrpaplpeair
    eriralegrp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cyeC (C:)
    megfpvrvrvdvrfrdldplghvnnavflsymelariryfqrispdwleeghfvvarmev
    dylrpillgdevfvgvrtvglgrsslrmehlvtangesaakglgvlvwleggrpaplpea
    ireriralegrpl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cyeD (D:)
    megfpvrvrvdvrfrdldplghvnnavflsymelariryfqrispdwleeghfvvarmev
    dylrpillgdevfvgvrtvglgrsslrmehlvtangesaakglgvlvwleggrpaplpea
    ireriralegrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cyeD (D:)
    gfpvrvrvdvrfrdldplghvnnavflsymelariryfqrispdwleeghfvvarmevdy
    lrpillgdevfvgvrtvglgrsslrmehlvtangesaakglgvlvwleggrpaplpeair
    erira