PDB entry 2cy9

View 2cy9 on RCSB PDB site
Description: Crystal structure of thioesterase superfamily member2 from Mus musculus
Class: hydrolase
Keywords: Structural Genomics, thioesterase superfamily member 2, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2005-07-06, released 2006-01-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.194
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioesterase superfamily member 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CQR4
      • modified residue (14)
      • modified residue (41)
      • modified residue (69)
      • modified residue (72)
      • modified residue (85)
      • modified residue (90)
    Domains in SCOPe 2.01: d2cy9a1
  • Chain 'B':
    Compound: Thioesterase superfamily member 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CQR4 (0-End)
      • modified residue (0)
      • modified residue (3)
      • modified residue (11)
      • modified residue (14)
      • modified residue (41)
      • modified residue (69)
      • modified residue (72)
      • modified residue (85)
      • modified residue (90)
    Domains in SCOPe 2.01: d2cy9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cy9A (A:)
    mssmtqnlrevmkvmfkvpgfdrvlekvtlvsaapeklicemkveeqhtnklgtlhgglt
    atlvdsistmalmctergapgvsvdmnitymspakigeeivitahilkqgktlafasvdl
    tnkttgkliaqgrhtkhlgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cy9A (A:)
    kvmfkvpgfdvlekvtlvsaapeklicemkveeqhtnklgtlhggltatlvdsistmalm
    ctpgvsvdmnitymspakigeeivitahilkqgktlafasvdltnkttgkliaqgrhtkh
    lg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cy9B (B:)
    mssmtqnlrevmkvmfkvpgfdrvlekvtlvsaapeklicemkveeqhtnklgtlhgglt
    atlvdsistmalmctergapgvsvdmnitymspakigeeivitahilkqgktlafasvdl
    tnkttgkliaqgrhtkhlgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cy9B (B:)
    mssmtqnlrevmkvmfgfdrvlekvtlvsaapeklicemkveeqhtnklgtlhggltatl
    vdsistmalmctepgvsvdmnitymspakigeeivitahilkqgktlafasvdltnkttg
    kliaqgrhtkhlg