PDB entry 2cy8

View 2cy8 on RCSB PDB site
Description: Crystal structure of D-phenylglycine aminotransferase (D-PhgAT) from Pseudomonas strutzeri ST-201
Class: transferase
Keywords: aminotransferase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2005-07-05, released 2006-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.186
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-phenylglycine aminotransferase
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cy8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cy8A (A:)
    msilndykrktegsvfwaqrarsvmpdgvtadtrafdphglfisdaqgvhktdvdgnvyl
    dffgghgalvlghghprvnaaiaealshgvqyaashplevrwaerivaafpsirklrftg
    sgtettllalrvaraftgrrmilrfeghyhgwhdfsasgynshfdgqpapgvlpettant
    llirpddiegmrevfanhgsdiaafiaepvgshfgvtpvsdsflregaelarqygalfil
    devisgfrvgnhgmqalldvqpdltclakasagglpggilggredvmgvlsrgsdrkvlh
    qgtftgnpitaaaaiaaidtileddvcakindlgqfareamnhlfarkglnwlaygrfsg
    fhlmpglppnttdtgsitraevarpdvkmiaamrmalilegvdiggrgsvflsaqhereh
    vehlvttfdrvldrladenllswqgtnlsgnqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cy8A (A:)
    silndykrktegsvfwaqrarsvmpdgafdphglfisdaqgvhktdvdgnvyldffgghg
    alvlghghprvnaaiaealshgvqyaashplevrwaerivaafpsirklrftgsgtettl
    lalrvaraftgrrmilrfegttantllirpddiegmrevfanhgsdiaafiaepvgshfg
    vtpvsdsflregaelarqygalfildevisgfrvgnhgmqalldvqpdltclakasaggl
    pggilggredvmgvlsrgsftgnpitaaaaiaaidtileddvcakindlgqfareamnhl
    farkglnwlaygrfsgfhlmpglppnttdtgsitraevarpdvkmiaamrmalilegvdi
    ggrgsvflsaqherehvehlvttfdrvldrladenllswqgt