PDB entry 2cy7

View 2cy7 on RCSB PDB site
Description: The crystal structure of human Atg4B
Class: hydrolase
Keywords: papain-like fold, autophagy, hydrolase
Deposited on 2005-07-05, released 2005-09-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine protease APG4B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cy7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cy7A (A:)
    gphmdaatltydtlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrkn
    fpaiggtgptsdtgwgcmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafid
    rkdsyysihqiaqmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvme
    eirrlcrtsvpcagatafpadsdrhcngfpagaevtnrpspwrplvlliplrlgltdine
    ayvetlkhcfmmpqslgviggkpnsahyfigyvgeeliyldphttqpaveptdgcfipde
    sfhcqhppcrmsiaeldpsiavgffckteddfndwcqqvkklsllggalpmfelveqqps
    hlacpdvlnlsldssdverlerffdsededfeilsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cy7A (A:)
    tltydtlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrknfpaiggt
    gptsdtgwgcmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafidrkdsyys
    ihqiaqmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvmeeirrlcr
    tsvpcspwrplvlliplrlgltdineayvetlkhcfmmpqslgviggkpnsahyfigyvg
    eeliyldphttqpavegcfipdesfhcqhppcrmsiaeldpsiavgffckteddfndwcq
    qvkklsllpmfelveqqpdvlnlsldssdverl