PDB entry 2cy5

View 2cy5 on RCSB PDB site
Description: Crystal structure of phosphotyrosine binding (PTB) domain of epidermal growth factor receptor pathway substrate-8 (EPS8) related protein 1 from Mus musculus (form-2 crystal)
Class: signaling protein
Keywords: structural genomics, signal transduction, phosphorylation, PTB domain, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-07-04, released 2006-01-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epidermal growth factor receptor pathway substrate 8-like protein 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB NP_080422
      • modified residue (4)
      • modified residue (39)
      • modified residue (50)
      • modified residue (85)
    Domains in SCOPe 2.08: d2cy5a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2cy5A (A:)
stvvmadvsqyhvnhlvtfclgeedgvhtvedasrklavmdsqgrvwaqemllrvspsqv
tlldpvskeelesypldaivrcdavmprgrsrsllllvcqeperaqpdvhffqglllgae
lirediqgalqnyrsgrger

    Sequence, based on observed residues (ATOM records): (download) 
    >2cy5A (A:)
madvsqyhvnhlvtfclgeedgvhtvedasrklavmdsqgrvwaqemllrvspsqvtlld
pvskeelesypldaivrcdavmprgrsrsllllvcqeperaqpdvhffqglllgaelire
diqgalqnyr