PDB entry 2cy3

View 2cy3 on RCSB PDB site
Description: crystal structure of cytochrome c3 from desulfovibrio desulfuricans norway at 1.7 angstroms resolution
Deposited on 1994-07-01, released 1994-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-15.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d2cy3__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cy3_ (-)
  adapgddyvisapegmkakpkgdkpgalqktvpfphtkhatvecvqchhtleadggavkk
  cttsgchdslefrdkanakdiklvenafhtqcidchkalkkdkkptgptacgkchttn