PDB entry 2cy3

View 2cy3 on RCSB PDB site
Description: crystal structure of cytochrome c3 from desulfovibrio desulfuricans norway at 1.7 angstroms resolution
Class: electron transport (heme protein)
Keywords: electron transport (heme protein)
Deposited on 1994-07-01, released 1994-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfomicrobium norvegicum [TaxId:52561]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cy3a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cy3A (A:)
    adapgddyvisapegmkakpkgdkpgalqktvpfphtkhatvecvqchhtleadggavkk
    cttsgchdslefrdkanakdiklvenafhtqcidchkalkkdkkptgptacgkchttn