PDB entry 2cxx

View 2cxx on RCSB PDB site
Description: Crystal structure of a probable GTP-binding protein engB
Class: cell cycle
Keywords: GTP-binding protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL CYCLE
Deposited on 2005-07-01, released 2006-01-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.164
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable GTP-binding protein engB
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57939
      • modified residue (50)
      • modified residue (56-57)
    Domains in SCOPe 2.06: d2cxxa1
  • Chain 'B':
    Compound: Probable GTP-binding protein engB
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57939
      • modified residue (50)
      • modified residue (56-57)
    Domains in SCOPe 2.06: d2cxxb_
  • Chain 'C':
    Compound: Probable GTP-binding protein engB
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57939
      • modified residue (50)
      • modified residue (56-57)
    Domains in SCOPe 2.06: d2cxxc_
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cxxA (A:)
    matiifagrsnvgkstliyrltgkkvrrgkrpgvtrkiieiewknhkiidmpgfgfmmgl
    pkevqerikdeivhfiednaknidvavlvvdgkaapeiikrwekrgeipidvefyqflre
    ldiptivavnkldkiknvqevinflaekfevplseidkvfipisakfgdnierlknrife
    virerqgrrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cxxA (A:)
    atiifagrsnvgkstliyrltgkkvrrgkrpgvtrkiieiewknhkiidmpgfgfmmglp
    kevqerikdeivhfiednaknidvavlvvdgkaapeiikrwekrgeipidvefyqflrel
    diptivavnkldkiknvqevinflaekfevplseidkvfipisakfgdnierlknrifev
    irer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cxxB (B:)
    matiifagrsnvgkstliyrltgkkvrrgkrpgvtrkiieiewknhkiidmpgfgfmmgl
    pkevqerikdeivhfiednaknidvavlvvdgkaapeiikrwekrgeipidvefyqflre
    ldiptivavnkldkiknvqevinflaekfevplseidkvfipisakfgdnierlknrife
    virerqgrrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cxxB (B:)
    atiifagrsnvgkstliyrltgkkvrrkiieiewknhkiidmpgfgfmmglpkevqerik
    deivhfiednaknidvavlvvdgkaapeiikrwekrgeipidvefyqflreldiptivav
    nkldkiknvqevinflaekfevplseidkvfipisakfgdnierlknrifevirer
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cxxC (C:)
    matiifagrsnvgkstliyrltgkkvrrgkrpgvtrkiieiewknhkiidmpgfgfmmgl
    pkevqerikdeivhfiednaknidvavlvvdgkaapeiikrwekrgeipidvefyqflre
    ldiptivavnkldkiknvqevinflaekfevplseidkvfipisakfgdnierlknrife
    virerqgrrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cxxC (C:)
    atiifagrsnvgkstliyrltgkkvrgvtrkiieiewknhkiidmpgfgfmmglpkevqe
    rikdeivhfiednaknidvavlvvdgkaapeiikrwekrgeipidvefyqflreldipti
    vavnkldkiknvqevinflaekfevplseidkvfipisakfgdnierlknrifevirer