PDB entry 2cxl

View 2cxl on RCSB PDB site
Description: RUN domain of Rap2 interacting protein x, crystallized in I422 space group
Class: protein binding
Keywords: RUN domain, helix bundle, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-06-30, released 2005-12-30
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.28
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rap2 interacting protein x
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D394 (7-End)
      • modified residue (7)
      • modified residue (12)
      • modified residue (15)
      • modified residue (17)
      • modified residue (50)
      • modified residue (114)
      • modified residue (122)
      • modified residue (142-143)
      • modified residue (166)
    Domains in SCOP 1.73: d2cxla1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2cxlA (A:)
gssgssgmanermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglk
akktflgqnksfwgplelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkkls
eymkalinkkellsefyevnalmmeeegaiiagllvglnvidanfcmkgedldsqvgvid
fsmylkdgns

    Sequence, based on observed residues (ATOM records): (download) 
    >2cxlA (A:)
manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkanksfwg
plelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkalinkkells
efyevnalmmeeegaiiagllvglnvidanfcmkgedl