PDB entry 2cxh

View 2cxh on RCSB PDB site
Description: Crystal structure of probable ribosomal biogenesis protein from Aeropyrum pernix K1
Class: RNA binding protein
Keywords: BRIX domain, 18S rRNA, IMP4, U3 snoRNP, ribosomal biogenesis, RNA-binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-06-29, released 2005-12-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable brix-domain ribosomal biogenesis protein
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: APE1443
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YC08
      • modified residue (71)
      • modified residue (200)
      • modified residue (209)
    Domains in SCOPe 2.06: d2cxha1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cxhA (A:)
    mgsshhhhhhssglvpagshmlggkgrpsgvggyrilvttsrrpsprirsfvkdlsatip
    gafrftrghysmeelareaiirgadrivvvgerrgnpgiirvyavegperpdnivsfivk
    gvslsrerrwglpslrggevlvarpldsgvavefadafviafharlkppeaagyveavie
    sldartvavtfryggapvgpmlrlgkpaemvkrgrrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cxhA (A:)
    gyrilvttsrrpsprirsfvkdlsatipgafrftrghysmeelareaiirgadrivvvge
    rrgnpgiirvyavegperpdnivsfivkgvslsrerrwglpslrggevlvarpldsgvav
    efadafviafharlkppeaagyveaviesldartvavtfryggapvgpmlrlgkpaemvk