PDB entry 2cxd

View 2cxd on RCSB PDB site
Description: Crystal structure of conserved hypothetical protein, TTHA0068 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: Structural Genomics, conserved hypothetical protein, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-06-28, released 2005-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: conserved hypothetical protein, TTHA0068
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SM75 (0-93)
    • modified residue (0)
    • modified residue (76)
  Domains in SCOPe 2.08: d2cxda_
• Chain 'B':
  Compound: conserved hypothetical protein, TTHA0068
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SM75 (0-93)
    • modified residue (0)
    • modified residue (76)
  Domains in SCOPe 2.08: d2cxdb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cxdA (A:)
  mvpdweevlglwragryyevhevlepywlkatgeerrllqgvillaaalhqrrlgrpglr
  nlrkaearleglpcplmgldwrsllqearrrlga
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cxdB (B:)
  mvpdweevlglwragryyevhevlepywlkatgeerrllqgvillaaalhqrrlgrpglr
  nlrkaearleglpcplmgldwrsllqearrrlga