PDB entry 2cxa

View 2cxa on RCSB PDB site
Description: Crystal structure of Leucyl/phenylalanyl-tRNA protein transferase from Escherichia coli
Class: transferase
Keywords: Transferase, aminoacyl-tRNA, protein degradation, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-06-28, released 2005-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.187
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leucyl/phenylalanyl-tRNA-protein transferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8P1 (17-End)
      • modified residue (17)
      • modified residue (56)
      • modified residue (94)
      • modified residue (107)
      • modified residue (160)
      • modified residue (174)
      • modified residue (178)
      • modified residue (230)
    Domains in SCOPe 2.08: d2cxaa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cxaA (A:)
    mrgshhhhhhtdpalramrlvqlsrhsiafpspegalrepngllalggdlsparllmayq
    rgifpwfspgdpilwwspdpravlwpeslhisrsmkrfhkrspyrvtmnyafgqviegca
    sdreegtwitrgvveayhrlhelghahsievwredelvggmygvaqgtlfcgesmfsrme
    nasktallvfceefighggklidcqvlndhtaslgaceiprrdylnylnqmrlgrlpnnf
    wvprclfspqeglcgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cxaA (A:)
    mrlvqlsrhsiafpspegalrepngllalggdlsparllmayqrgifpwfspgdpilwws
    pdpravlwpeslhisrsmkrfhkrspyrvtmnyafgqviegcasdgtwitrgvveayhrl
    helghahsievwredelvggmygvaqgtlfcgesmfsrmenasktallvfceefighggk
    lidcqvlndhtaslgaceiprrdylnylnqmrlgrlpnnfwvprclfsp