PDB entry 2cx5

View 2cx5 on RCSB PDB site
Description: Crystal structure of a putative trans-editing enzyme for prolyl tRNA synthetase
Class: translation
Keywords: trans-editing domain, prolyl-tRNA synthetase, RSGI, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, TRANSLATION
Deposited on 2005-06-28, released 2005-12-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: a putative trans-editing enzyme
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2cx5a_
  • Chain 'B':
    Compound: a putative trans-editing enzyme
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2cx5b_
  • Chain 'C':
    Compound: a putative trans-editing enzyme
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2cx5c_
  • Chain 'D':
    Compound: a putative trans-editing enzyme
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2cx5d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cx5A (A:)
    mslspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvfvgekga
    ylflvsgknrldlgkatrlvggplrqatpeevreltgfaiggvppvghntplpayldedl
    lgypevwaaggtpralfratpkellaltgaqvadlkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cx5A (A:)
    slspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvfvgekgay
    lflvsgknrldlgkatrlvggplrqatpeevreltgfaiggvppvghntplpayldedll
    gypevwaaggtpralfratpkellaltgaqvadlkeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cx5B (B:)
    mslspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvfvgekga
    ylflvsgknrldlgkatrlvggplrqatpeevreltgfaiggvppvghntplpayldedl
    lgypevwaaggtpralfratpkellaltgaqvadlkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cx5B (B:)
    slspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvfvgekgay
    lflvsgknrldlgkatrlvggplrqatpeevreltgfaiggvppvghntplpayldedll
    gypevwaaggtpralfratpkellaltgaqvadlkeg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cx5C (C:)
    mslspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvfvgekga
    ylflvsgknrldlgkatrlvggplrqatpeevreltgfaiggvppvghntplpayldedl
    lgypevwaaggtpralfratpkellaltgaqvadlkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cx5C (C:)
    slspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvfvgekgay
    lflvsgknrldlgkatrlvggplrqatpeevreltgfaiggvppvghntplpayldedll
    gypevwaaggtpralfratpkellaltgaqvadlkeg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cx5D (D:)
    mslspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvfvgekga
    ylflvsgknrldlgkatrlvggplrqatpeevreltgfaiggvppvghntplpayldedl
    lgypevwaaggtpralfratpkellaltgaqvadlkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cx5D (D:)
    slspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvfvgekgay
    lflvsgknrldlgkatrlvggplrqatpeevreltgfaiggvppvghntplpayldedll
    gypevwaaggtpralfratpkellaltgaqvadlkeg