PDB entry 2cx1

View 2cx1 on RCSB PDB site
Description: Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (tartrate complex)
Class: structural genomics, unknown function
Keywords: PUA domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-06-27, released 2005-12-27
The last revision prior to the SCOP 1.75 freeze date was dated 2005-12-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.163
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein APE0525
    Species: Aeropyrum pernix
    Gene: APE0525
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YEQ6 (1-End)
      • his tag (0)
      • modified residue (1)
      • modified residue (111)
      • modified residue (140)
    Domains in SCOP 1.75: d2cx1a1, d2cx1a2
  • Heterogens: TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cx1A (A:)
    hmlwarlvglarlearalskkerrsllerlkpyytripfsekadlrlvkartdsgeyeii
    tvdgvpclfewsdgriyptlqclkafgvdwlkgvvlvdkgaaialakgahlmipgvvgve
    gsftrgdvvaalyhetrtpvmvgvaevdssaleklyrekargravrrvhrlgdalwelaq
    evgkrls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cx1A (A:)
    hmlwarlvglarlearalskkerrsllerlkpyytripfsekadlrlvkartdsgeyeii
    tvdgvpclfewsdgriyptlqclkafgvdwlkgvvlvdkgaaialakgahlmipgvvgve
    gsftrgdvvaalyhetrtpvmvgvaevdssaleklyrekargravrrvhrlgdalwelaq
    evgk