PDB entry 2cwz

View 2cwz on RCSB PDB site
Description: Crystal structure of the Thermus thermophilus hypothetical protein TTHA0967, a thioesterase superfamily member
Class: hydrolase
Keywords: Structural genomics, thioesterase, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-06-27, released 2005-12-27
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.204
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioesterase family protein
    Species: Thermus thermophilus
    Gene: TTHA0967
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJP1 (0-End)
      • modified residue (0)
      • modified residue (19)
      • modified residue (38)
      • modified residue (42)
      • modified residue (77)
    Domains in SCOP 1.73: d2cwza1
  • Chain 'B':
    Compound: thioesterase family protein
    Species: Thermus thermophilus
    Gene: TTHA0967
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJP1 (0-End)
      • modified residue (0)
      • modified residue (19)
      • modified residue (38)
      • modified residue (42)
      • modified residue (77)
    Domains in SCOP 1.73: d2cwzb1
  • Chain 'C':
    Compound: thioesterase family protein
    Species: Thermus thermophilus
    Gene: TTHA0967
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJP1 (0-End)
      • modified residue (0)
      • modified residue (19)
      • modified residue (38)
      • modified residue (42)
      • modified residue (77)
    Domains in SCOP 1.73: d2cwzc1
  • Chain 'D':
    Compound: thioesterase family protein
    Species: Thermus thermophilus
    Gene: TTHA0967
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJP1 (0-End)
      • modified residue (0)
      • modified residue (19)
      • modified residue (38)
      • modified residue (42)
      • modified residue (77)
    Domains in SCOP 1.73: d2cwzd1
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cwzA (A:)
    mrpipegyeavfetvvtpemtvrfeelgpvhpvyatywmvkhmelagrkiilpfleegee
    gigsyvearhlasalpgmrvrvvarhektegnrvyarveaynelgdligvgrteqvilpk
    akvealfrrlkerweaersps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwzA (A:)
    mrpipegyeavfetvvtpemtvrfeelgpvhpvyatywmvkhmelagrkiilpfleegee
    gigsyvearhlasalpgmrvrvvarhektegnrvyarveaynelgdligvgrteqvilpk
    akvealfrrlkerweaer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cwzB (B:)
    mrpipegyeavfetvvtpemtvrfeelgpvhpvyatywmvkhmelagrkiilpfleegee
    gigsyvearhlasalpgmrvrvvarhektegnrvyarveaynelgdligvgrteqvilpk
    akvealfrrlkerweaersps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwzB (B:)
    mrpipegyeavfetvvtpemtvrfeelgpvhpvyatywmvkhmelagrkiilpfleegee
    gigsyvearhlasalpgmrvrvvarhektegnrvyarveaynelgdligvgrteqvilpk
    akvealfrrlkerweae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cwzC (C:)
    mrpipegyeavfetvvtpemtvrfeelgpvhpvyatywmvkhmelagrkiilpfleegee
    gigsyvearhlasalpgmrvrvvarhektegnrvyarveaynelgdligvgrteqvilpk
    akvealfrrlkerweaersps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwzC (C:)
    mrpipegyeavfetvvtpemtvrfeelgpvhpvyatywmvkhmelagrkiilpfleegee
    gigsyvearhlasalpgmrvrvvarhektegnrvyarveaynelgdligvgrteqvilpk
    akvealfrrlkerweae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cwzD (D:)
    mrpipegyeavfetvvtpemtvrfeelgpvhpvyatywmvkhmelagrkiilpfleegee
    gigsyvearhlasalpgmrvrvvarhektegnrvyarveaynelgdligvgrteqvilpk
    akvealfrrlkerweaersps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwzD (D:)
    mrpipegyeavfetvvtpemtvrfeelgpvhpvyatywmvkhmelagrkiilpfleegee
    gigsyvearhlasalpgmrvrvvarhektegnrvyarveaynelgdligvgrteqvilpk
    akvealfrrlkerweae