PDB entry 2cww

View 2cww on RCSB PDB site
Description: Crystal structure of Thermus thermophilus TTHA1280, a putative SAM-dependent RNA methyltransferase, in complex with S-adenosyl-L-homocysteine
Class: transferase
Keywords: Structural genomics, SAM-dependent RNA methyltransferase, S-adenosyl-L-homocysteine, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2005-06-27, released 2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.258
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative SAM-dependent RNA methyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA1280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cwwa1, d2cwwa2
  • Chain 'B':
    Compound: putative SAM-dependent RNA methyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA1280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cwwb1, d2cwwb2
  • Heterogens: SAH, ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cwwA (A:)
    mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
    rfapaedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvq
    atahawegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrv
    rylvdlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdss
    aealrraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdvera
    yraykevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpf
    dhpvllnhpethylkfavfqvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwwA (A:)
    mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
    rfapaedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvq
    atahawegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrv
    rylvdlgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdssaealrr
    aeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdverayrayke
    vnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpfdhpvll
    nhpethylkfavfqvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cwwB (B:)
    mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
    rfapaedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvq
    atahawegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrv
    rylvdlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdss
    aealrraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdvera
    yraykevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpf
    dhpvllnhpethylkfavfqvl