PDB entry 2cws

View 2cws on RCSB PDB site
Description: Crystal structure at 1.0 A of alginate lyase A1-II', a member of polysaccharide lyase family-7
Class: lyase
Keywords: alginate lyase, polysaccharide lyase family-7, LYASE
Deposited on 2005-06-25, released 2005-11-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.11
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alginate lyase A1-II'
    Species: Sphingomonas sp. A1 [TaxId:90322]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q75WP3 (Start-228)
      • expression tag (229)
    Domains in SCOPe 2.05: d2cwsa_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cwsA (A:)
    mpaaapgknfdlshwklqlpdantteissanlglgytsqyfytdtdgamtfwapttggtt
    anssyprselremldpsnskvnwgwqgthtmklsgktvqlpssgkiivaqihgimddgtn
    applvkavfqdgqldmqvkqnsdgtgsdvhnyftgiklgdlynmeirvtdgvayvtmngd
    trsvdfvgkdagwknlkyyfkagnyvqdntstggsaiaklyslsvshsnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwsA (A:)
    aapgknfdlshwklqlpdantteissanlglgytsqyfytdtdgamtfwapttggttans
    syprselremldpsnskvnwgwqgthtmklsgktvqlpssgkiivaqihgimddgtnapp
    lvkavfqdgqldmqvkqnsdgtgsdvhnyftgiklgdlynmeirvtdgvayvtmngdtrs
    vdfvgkdagwknlkyyfkagnyvqdntstggsaiaklyslsvshsnl