PDB entry 2cwq

View 2cwq on RCSB PDB site
Description: Crystal structure of conserved protein TTHA0727 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: Conserved Hypothetical Protein, All Alpha, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-06-23, released 2005-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.165
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TTHA0727
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0727
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SMF5 (20-136)
      • expression tag (11-19)
      • modified residue (20)
      • modified residue (31)
      • modified residue (65)
      • modified residue (96)
    Domains in SCOPe 2.08: d2cwqa1, d2cwqa2
  • Chain 'B':
    Compound: hypothetical protein TTHA0727
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0727
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SMF5 (20-136)
      • expression tag (11-19)
      • modified residue (20)
      • modified residue (31)
      • modified residue (65)
      • modified residue (96)
    Domains in SCOPe 2.08: d2cwqb2, d2cwqb3
  • Chain 'C':
    Compound: hypothetical protein TTHA0727
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0727
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SMF5 (Start-136)
      • modified residue (31)
      • modified residue (65)
      • modified residue (96)
    Domains in SCOPe 2.08: d2cwqc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cwqA (A:)
    mgsshhhhhhssglvprgshmdrthervlqamaenlgeglpraipllaekapglllehgr
    swtyampekgaldektrtlillgialatgseacvkamahrakrlglskealletlkiarq
    aqanavlghaapllevl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwqA (A:)
    sglvprgshmdrthervlqamaenlgeglpraipllaekapglllehgrswtyampekga
    ldektrtlillgialatgseacvkamahrakrlglskealletlkiarqaqanavlghaa
    pllevl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cwqB (B:)
    mgsshhhhhhssglvprgshmdrthervlqamaenlgeglpraipllaekapglllehgr
    swtyampekgaldektrtlillgialatgseacvkamahrakrlglskealletlkiarq
    aqanavlghaapllevl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwqB (B:)
    sglvprgshmdrthervlqamaenlgeglpraipllaekapglllehgrswtyampekga
    ldektrtlillgialatgseacvkamahrakrlglskealletlkiarqaqanavlghaa
    pllevl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cwqC (C:)
    mgsshhhhhhssglvprgshmdrthervlqamaenlgeglpraipllaekapglllehgr
    swtyampekgaldektrtlillgialatgseacvkamahrakrlglskealletlkiarq
    aqanavlghaapllevl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwqC (C:)
    ervlqamaenlgeglpraipllaekapglllehgrswtyampekgaldektrtlillgia
    latgseacvkamahrakrlglskealletlkiarqaqanavlghaapllevl