PDB entry 2cwp

View 2cwp on RCSB PDB site
Description: Crystal structure of MetRS related protein from Pyrococcus horikoshii
Class: ligase
Keywords: MetRS related protein, Pyrococcus horikoshii, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, LIGASE
Deposited on 2005-06-23, released 2005-12-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.214
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: MetRS related protein
  Species: Pyrococcus horikoshii [TaxId:53953]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O58023 (Start-111)
  Domains in SCOPe 2.03: d2cwpa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2cwpA (A:)
  mnymelydvdefwkfqmkvglvkkaekikrtkkliklivdfgneertivtgiadqippee
  legkkfifvvnlkpkkfsgvesqgmlilaetedgkvylipvpeevpvgarvw
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2cwpA (A:)
  melydvdefwkfqmkvglvkkaekikrtkkliklivdfgneertivtgiadqippeeleg
  kkfifvvnlkpkkfsgvesqgmlilaetedgkvylipvpeevpvgarvw