PDB entry 2cwn

View 2cwn on RCSB PDB site
Description: Crystal structure of mouse transaldolase
Class: transferase
Keywords: Structural Genomics, Transaldolase, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2005-06-22, released 2005-12-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transaldolase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93092 (7-End)
      • cloning artifact (5-6)
      • engineered (204)
    Domains in SCOPe 2.08: d2cwna1, d2cwna2
  • Chain 'B':
    Compound: Transaldolase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93092 (7-End)
      • engineered (204)
    Domains in SCOPe 2.08: d2cwnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cwnA (A:)
    gssgssgsaldqlkqfttvvadtgdfnaideykpqdattnpslilaaaqmpayqelveea
    iaygkklggpqeeqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrl
    ielykeagvgkdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacaeagvtl
    ispfvgrildwhvantdkksyepqgdpgvksvtkiynyykkfgyktivmgasfrntgeik
    alagcdfltispkllgellkdnsklapalsvkaaqtsdsekihldekafrwlhnedqmav
    eklsdgirkfaadaiklermltermfsaengk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwnA (A:)
    sgsaldqlkqfttvvadtgdfnaideykpqdattnpslilaaaqmpayqelveeaiaygk
    klggpqeeqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrlielyk
    eagvgkdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacaeagvtlispfv
    grildwhvantdkksyepqgdpgvksvtkiynyykkfgyktivmgasfrntgeikalagc
    dfltispkllgellkdnsklapalsvkaaqtsdsekihldekafrwlhnedqmaveklsd
    girkfaadaiklermltermf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cwnB (B:)
    gssgssgsaldqlkqfttvvadtgdfnaideykpqdattnpslilaaaqmpayqelveea
    iaygkklggpqeeqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrl
    ielykeagvgkdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacaeagvtl
    ispfvgrildwhvantdkksyepqgdpgvksvtkiynyykkfgyktivmgasfrntgeik
    alagcdfltispkllgellkdnsklapalsvkaaqtsdsekihldekafrwlhnedqmav
    eklsdgirkfaadaiklermltermfsaengk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwnB (B:)
    saldqlkqfttvvadtgdfnaideykpqdattnpslilaaaqmpayqelveeaiaygkkl
    ggpqeeqiknaidklfvlfgaeilkkipgrvstevdarlsfdkdamvararrlielykea
    gvgkdriliklsstwegiqagkeleeqhgihcnmtllfsfaqavacaeagvtlispfvgr
    ildwhvanqgdpgvksvtkiynyykkfgyktivmgasfrntgeikalagcdfltispkll
    gellkdnsklapalsvkaaqtsdsekihldekafrwlhnedqmaveklsdgirkfaadai
    klermltermfs